SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000021903 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000021903
Domain Number 1 Region: 27-144
Classification Level Classification E-value
Superfamily Immunoglobulin 2.1e-17
Family V set domains (antibody variable domain-like) 0.0086
Further Details:      
 
Domain Number 2 Region: 137-233
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000224
Family I set domains 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000021903   Gene: ENSDNOG00000040420   Transcript: ENSDNOT00000051094
Sequence length 324
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569228.1:906200:951837:1 gene:ENSDNOG00000040420 transcript:ENSDNOT00000051094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGKTRPVLWTLCAFWVSVGAIIVEAPQDAFRAARGENVTLPCTYHTSNTNRRGLIQWDK
LLLSHTVKVVTWTFEEKQYTYGDLYKNRVKVSSNAEQSDASITISQLTMDDNGTYECSVS
LLSDLEGISKARVRLLVLVPPSKPVCAIEGETVIGNNIKLTCKSEEGSPEPQYSWKSYDI
LNQERPLAPPVTGQTLSLKNISTDMSGYYLCFSSNEIRTQSCNISLSVRPPSMNVALYAG
IAGGVAAALIIIGIIIYCCCFRRKDEDKLDTRPNREIYRQPPEQLREVSRGQEEEDSYRR
EEEDSYRREDERSSGRETPDRPGR
Download sequence
Identical sequences XP_004464776.1.11602 ENSDNOP00000021903

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]