SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022142 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000022142
Domain Number 1 Region: 33-151
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.05e-30
Family Hormone receptor domain 0.0025
Further Details:      
 
Domain Number 2 Region: 110-409
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000238
Family Rhodopsin-like 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022142   Gene: ENSDNOG00000036313   Transcript: ENSDNOT00000042861
Sequence length 462
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575726.1:1528800:1575431:-1 gene:ENSDNOG00000036313 transcript:ENSDNOT00000042861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEKSHILYFLFLLPYFMSLAIAESEEESQSNLIQLGVTRNKIMTAQYECYQKIMQDPIQ
QTEGVYCNRTWDGWLCWNDVVAGTESMQLCPDYFQDFDPSEKVTKICDQDGNWFRHPASN
RTWTNYTQCNVNTHAKVQTALNLFYLTIIGHGLSIASLLISLGIFFYFKSLSCQRITLHK
NLFFSFVCNSIVTIVHLTAVANNQPYVATNPVSCKVFQFIHLYLMGCNYFWMLCEGIYLH
TLIVVAVFAEKQHLMWYYFLGWGFPLIPAFIHAVARSLYYNDNCWISSDTHLLYIIHGPI
CAALLVNLFFLLNIVRVLITKLKVTHQAESNLYMKAVRATLILVPLLGIEFVLIPWRPEG
RIAEEVYDYIMHILMHYQGLLVSTIFCFFNGEVQAILRRNWNQYKIQFGNSFSPSDALRS
ASYTVSTISDHGSSHDYPSEHLNGKSIHDIENVVLNSENLYV
Download sequence
Identical sequences XP_004477100.1.11602 XP_012374473.1.11602 XP_012374474.1.11602 XP_012374475.1.11602 XP_012374476.1.11602 ENSDNOP00000022142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]