SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022278 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000022278
Domain Number - Region: 123-161
Classification Level Classification E-value
Superfamily PRP4-like 0.0248
Family PRP4-like 0.01
Further Details:      
 
Domain Number - Region: 9-84
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0706
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022278   Gene: ENSDNOG00000047905   Transcript: ENSDNOT00000050177
Sequence length 238
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583683.1:20924:42249:-1 gene:ENSDNOG00000047905 transcript:ENSDNOT00000050177 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAQASSSQDAEPWYFHPVYARYWQHYHQAMAWMQSHQRAYRKALESYYSSPWFSPPAVF
PPSSQQREYPQSSHHHLASQDSPYRYPHSRKSGPHPHGSRRAQASMRVVQAPSVEEETES
ESDMEIECDLSNMEITEELRQYFAETERHRAERRRQQKLDEARLDDYVGADHDLYYITRR
SVEPPSERPGERRQAEMKRLYGDSAAKIQAMEAAVQLSFDKHCDRKRPKYWPVIPLKF
Download sequence
Identical sequences ENSDNOP00000022278 XP_004484372.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]