SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022408 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000022408
Domain Number 1 Region: 122-264
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0000196
Family At5g01750-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022408   Gene: ENSDNOG00000043070   Transcript: ENSDNOT00000037112
Sequence length 272
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578663.1:627189:649354:-1 gene:ENSDNOG00000043070 transcript:ENSDNOT00000037112 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HSFADAQNQRGRSLPSFLPGSPEPDQNLHASPSNPGNQAWEPGLSPPGTFLPTVSLPPGL
EYLSQLDLIIIHQQVELLGMILGTETSNKYEIKNRMGQRIYFAVEESICFNRTFCSTLRS
CTLRITDNSGREVMTVNRPLRCNSCWCPCYLQELEIQAPPGTIVGYVAQKWDPFLPKFAI
QNANKEDILKIVGPCATCGCFGDVDFEVKTINEKLTIGKISKYWSGFVNDVFTNADNFGI
HVPDLDVTVKAAMIGACFLFDFMFFEHSLAGL
Download sequence
Identical sequences ENSDNOP00000022408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]