SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022645 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000022645
Domain Number 1 Region: 116-245
Classification Level Classification E-value
Superfamily TNF-like 1.89e-38
Family TNF-like 0.000000448
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022645   Gene: ENSDNOG00000039694   Transcript: ENSDNOT00000047379
Sequence length 248
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569998.1:244207:252112:-1 gene:ENSDNOG00000039694 transcript:ENSDNOT00000047379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKTLWGGVLPLLLLSLPDASCAQSSCTGPATIPGTPGIPGRPGSDGQPGTPGIKGAKGLP
GLAGDHGEYGEKGDPGIPGNPGKVGPKGPVGPKGSPGPPGARGPKGESGDYKATQKIAFS
ATRTVTTPLRRDQTIRFDHVITNENNNYEPRSGKFTCKVPGLYYFTFHASSRGNLCVNLV
RGRERPQRVVAFCDFVHSSFQVTTGGVVLKLGLGENVFLQATDRNSLLGLDGANSIFSGF
LLFPDAEA
Download sequence
Identical sequences XP_004468355.1.11602 ENSDNOP00000022645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]