SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000022943 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000022943
Domain Number 1 Region: 166-319
Classification Level Classification E-value
Superfamily TNF-like 6.96e-52
Family TNF-like 0.0000000767
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000022943
Domain Number - Region: 34-41
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00628
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000022943   Gene: ENSDNOG00000042601   Transcript: ENSDNOT00000036915
Sequence length 320
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568994.1:736528:773581:-1 gene:ENSDNOG00000042601 transcript:ENSDNOT00000036915 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRASRDYTKYLRGSEEMGSGGSGAPHEGPLHAPPPPPPPPHQPPAASRSMFVALLGLGL
GQVVCSVALFLYFRAQMDPNRISEDDTDCFKRFFKLHENADLQDMTLESQGTKLIPDSCS
GIKEAFQGAVQKELQHIVGSRHLRAEQAMVEGSWLGLASRSKPETQPFAHLTINATDIPS
GSHKVSLSSWYYDRGWAKISNMTFSNGKLVVNQDGFYYLYANICFRHHETSGDLATEYLQ
LMVYVTKTSIKIPRSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPS
LLDPDQDATYFGAFKVRDID
Download sequence
Identical sequences A0A0U5J487
XP_004463640.1.11602 ENSDNOP00000022943

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]