SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023063 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023063
Domain Number 1 Region: 133-217
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000215
Family I set domains 0.0000957
Further Details:      
 
Domain Number 2 Region: 48-130
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000102
Family I set domains 0.00016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023063   Gene: ENSDNOG00000031629   Transcript: ENSDNOT00000046832
Sequence length 270
Comment pep:novel scaffold:Dasnov3.0:JH578810.1:1234555:1244434:1 gene:ENSDNOG00000031629 transcript:ENSDNOT00000046832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVGRRLFTSFFLVSKFPVGLERVCSTMWQLLPPTALLLLVAAGLQTDLPKAVVLLDPPWD
RVLKDDSVTLRCQGTYPPGDNSTQWLLNGNLISNQDPSYLITEAIPENSGEYRCQTKLST
LSDPVQLRVHAGWLVLQSHRWVYQEGEPIQLRCHSWKNQKFQKVTYLQDGVPKKFFHNNS
NLYIPKAALSDNGSYFCRGLIGIKNESSESVDILVQGTAVPSISVLSPPWHQIAFCLLMG
VLFAVDTGLYLSMQRHFRSSVGRLENHQTK
Download sequence
Identical sequences ENSDNOP00000023063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]