SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023180 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023180
Domain Number 1 Region: 70-200
Classification Level Classification E-value
Superfamily TNF-like 1.95e-29
Family TNF-like 0.00073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023180   Gene: ENSDNOG00000046405   Transcript: ENSDNOT00000042139
Sequence length 201
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562075.1:306041:313381:1 gene:ENSDNOG00000046405 transcript:ENSDNOT00000042139 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAGRALSVVPAVLLALALPALPVWAQNDTEPIVLEGKCLVVCDSNPATDSKGSSSSPL
GISVRAANSKVAFSAVRSTNHEPSEMSNKTRIIYFDQILVNVGNFFTLESVFVAPRKGIY
SFSFHVIKVYQSQTIQVNLMLNGKPVISAFAGDKDVTREAATNGVLLYLDKEDKVYLKLE
KGNLVGGWQYSTFSGFLVFPL
Download sequence
Identical sequences ENSDNOP00000023180 XP_004447770.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]