SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023477 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023477
Domain Number 1 Region: 3-284
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.86e-71
Family FCH domain 0.0028
Further Details:      
 
Domain Number 2 Region: 482-543
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 5.49e-21
Family Pyk2-associated protein beta ARF-GAP domain 0.0029
Further Details:      
 
Domain Number 3 Region: 382-454
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000223
Family SH3-domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023477   Gene: ENSDNOG00000044349   Transcript: ENSDNOT00000042539
Sequence length 985
Comment pep:known_by_projection scaffold:Dasnov3.0:JH570833.1:42213:169624:-1 gene:ENSDNOG00000044349 transcript:ENSDNOT00000042539 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLVEKGPQYGTVE
KAWVAVMSEAERVSELHLEVKASLMNEDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRK
AQKPWAKKLKEVQCCKKAYHTACKEEKLATSRETNSKIDPSLNPEQLKKLQDKVEKCKQD
VLKTKEKYEKSLKELDQSTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNL
ASYKNIYHDLEQSIKAADAVEDLRWFRANHGPGMSMNWPQFEEWSADLNRTLSRREKKKA
ADGVTLMGINQTGDQSLQNKHSSSSLSVPSNPAQSAQSQSSYNPFEDEDDTGSTVSEKED
IKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFEEDTTSGTEVRVRALYDYEG
QEHDELSFKAGDELTKIEDEDEQGWCKGRLDDGQSFGQFLIGSFVFLLLLNKSHLLVMYK
SFVCIPGSKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRWKEPDRQCTFF
QISCYQLTSVTNINTVMFFYYKGCILGSCEHHHYGHRCADVYSSEKLKQILSNQRYTNGL
KLSYPCTIEPSSSTPRQKIYLLRSSPNVGGLKTDFSPTPPPPAWLTRKLDIFPGNFSGGP
EKGPSVEGLNVPTKAALEVSSIIKKKPNQAKKGLGAKKGSLGAQKLTNKCFNEIEKQAQA
VDKMKEQEDLARVAPKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKKIESERLGMGFGN
CRSGISHSVTSDMQTIEQETPIMAKPRKKYSDDNGDSYFTSSSRYFDEPVELRSSSFSNW
DDSSDSYWIKDTVKDTESILKATGYSDRPTARRKPDYASVENTDEAQKKFGNVKAISSDM
YFGRQDQADYETRARLERLSASSSISSADLFDEQRKQASGNYNLTSVLPSAPDMAQFKQG
VKSVAGKLSVFANGVMTSIQDRYGS
Download sequence
Identical sequences ENSDNOP00000023477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]