SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023527 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023527
Domain Number 1 Region: 3-181
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.67e-49
Family BAR domain 0.0000292
Further Details:      
 
Domain Number 2 Region: 689-765
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000254
Family SH3-domain 0.0000807
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023527   Gene: ENSDNOG00000045883   Transcript: ENSDNOT00000051229
Sequence length 766
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568752.1:3437848:3571112:1 gene:ENSDNOG00000045883 transcript:ENSDNOT00000051229 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEGTRLQRELRGYLAAIKGMQEASMKLTESLHEVYEPDWYGREDVKMVGEKCDVLWEDFH
QKLVDGSLLTLDTYLGQFPDIKNRIAKRSRKLVDYDSARHHLEALQGSKRKDESRISKAE
EEFQKAQKVFEEFNVDLQEELPSLWSRRVGFYVNTFKNVSSLEAKFHKEIAVLCHKLYEV
MTKLGDQHADKAFTIQGAPSDSGPLRIAKTPSPPEDASPIPSPIASPNHTLAPASPAPAR
PKSPSQTRKGPPVPPLPKVTPTKELQQENIINFFEDNFVPEISVTTPSQNEVPEVKKEET
LLDLDFDPFKPEVASVGSAGMAHSPMSQVIPMEWTTEESKQEKICNLISKHCNSSFLIQK
MVREQVLQAGFFFFPPIQTSTDLVQPGGSQEESAGLFEAEQGMGFSTGMLTSVNWVTVAE
QGECVLGPVSPGGNEKLSPEPEPEAGFAIATYMEMEQPYESSLDSESPAMETGGLFKQSH
EDDKKSEEEEEKQKMEDPMWAGVETCEKASGGSFNGFTQPQDTSLFTMQSDQSMICNFIA
PELEADGVVGSQISAAEGVPAEEAVAEKAALPAEEGVSSEEAKTDTETAEAEDGDRPLPG
ETEAAAPQEKVIPSVVIEPASNHEGEGEHEVIVGAEAQEAPEVAAPLGPASETPALATEG
KTPEEPQPAPLAPAADADQVVPAGDATQELPPGFLYKVETLHDFEAANSDELTLHRGDVV
LVVPSDSEADQDAGWLVGVKESDWLQYRDLATHKGLFPENFTRRLD
Download sequence
Identical sequences ENSDNOP00000023527

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]