SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023674 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023674
Domain Number 1 Region: 13-114
Classification Level Classification E-value
Superfamily TNF-like 8.7e-19
Family TNF-like 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023674   Gene: ENSDNOG00000039600   Transcript: ENSDNOT00000050073
Sequence length 121
Comment pep:novel scaffold:Dasnov3.0:JH576441.1:2247166:2247543:1 gene:ENSDNOG00000039600 transcript:ENSDNOT00000050073 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GVPGVIEKCPTPPKSAFSVKLNETIQNPFQPIVFRDADYFNLTTEMFSCTNPGVFNFGFD
IGLFQKSVKIALMRNGIQIREKQAQAKDSYKYVSGMAMMQLEEGEKVLLESKLNEAESEK
G
Download sequence
Identical sequences ENSDNOP00000023674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]