SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000023744 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000023744
Domain Number 1 Region: 134-271
Classification Level Classification E-value
Superfamily TNF-like 8.03e-38
Family TNF-like 0.00028
Further Details:      
 
Domain Number 2 Region: 47-56
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.00000123
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000023744
Domain Number - Region: 6-63
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0418
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000023744   Gene: ENSDNOG00000035125   Transcript: ENSDNOT00000050458
Sequence length 271
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569632.1:529223:536939:1 gene:ENSDNOG00000035125 transcript:ENSDNOT00000050458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQRPLNYPYPQIFWVDSSASSPWAPPGPVLPCPASGPGRPGQRRPPPPPPPPPPPPPLPP
PPPKRDHSTGLCLLMMFFMVLVALVGLGLGMFQIFHLQKELAELRESTSQRDLESSLEKQ
IGHPSPPAEKRELKKVAHLTGNPNSRSIPLEWEDTYGIALVSGVKYKKGGLMINDTGLYF
VYSKVYFRGQSCNNKPLSHKVYMRHSRYPQDLVLMEGKMMDYCTTGQMWARSSYLGAVFN
LTTADHLYVNVSELSLVSFEESKTFFGLYKL
Download sequence
Identical sequences ENSDNOP00000023744 XP_004466898.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]