SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024111 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024111
Domain Number 1 Region: 2-208
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.49e-57
Family FCH domain 0.00000000561
Further Details:      
 
Domain Number 2 Region: 487-556
Classification Level Classification E-value
Superfamily SH3-domain 7.88e-16
Family SH3-domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000024111
Domain Number - Region: 354-424
Classification Level Classification E-value
Superfamily HR1 repeat 0.0191
Family HR1 repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024111   Gene: ENSDNOG00000019220   Transcript: ENSDNOT00000051103
Sequence length 566
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568881.1:105277:206637:-1 gene:ENSDNOG00000019220 transcript:ENSDNOT00000051103 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNDYAGQHEVISENMTSQITVELARYVQELKQERKSHFLEGRKAQQHIETCWKQLETSKR
RFERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNR
EQHEYYRTHIPNIFQKIQEMEERRILRIGESMKTYAEVDRQVIPIIGKCLDGIVKAADSI
DQKNDSQLVIEAYKSGFEPPGDIDFEDYTQPMKRTLSENSLSNSRGEGKSEVKFGGKSKG
KLWPFIKKNKLMSLLTSPHQPPPPPPASASPSAVPNGPQSPKQPKEPLSHRFNEFMTSKP
KIHCFRSLKRGTQSFCFHKELMKRTIGKPTYAFEARDYVLSLKLGATPEDFSNLPPEQRR
KKLQQKVDELNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLVEVGQNIEKLRLE
AQKFESWLAEVEGRLPARSEQARRQSGMYDAQNTPPVNNCAQDRESPDGSYTEEQSQESE
VKVLATDFDDEFDDEEPLPAIGTCRALYTFEGQNEGTISVAEGETLYVIEEDKGDGWTRI
RRNEDEEGYVPTSYVEVYLDKNAKDS
Download sequence
Identical sequences ENSDNOP00000024111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]