SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024340 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024340
Domain Number 1 Region: 94-186
Classification Level Classification E-value
Superfamily Hormone receptor domain 5.49e-25
Family Hormone receptor domain 0.00091
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000024340
Domain Number - Region: 235-438
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.000146
Family Rhodopsin-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024340   Gene: ENSDNOG00000041987   Transcript: ENSDNOT00000044171
Sequence length 547
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569109.1:100564:111408:-1 gene:ENSDNOG00000041987 transcript:ENSDNOT00000044171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSPRGSPLLSPPPPVSSQALVDVDDVMTKEEQIILLHRAQAQCEKRLKEVLRRPGGLGPG
AEGLGHGQERQGQARVGAWDGRSASWEASGGGRGTGHPCMPEWDHILCWPLGPPGEVVAV
PCPDYIYDFNHKGHAYRRCDRNGSWELVPGHNRTWANYSECVKFLTNETREREVFDRLGM
IYTVGYSVXLRAVSIFVKDAVLYSGAALDEAERLTEEELRAIAQAPPPPTVPAAGYAGCR
VAVTFFLYFLATNYYWILVEGLYLHSLIFMAFFSEKKYLWGFTVFGWGLPATFVAVWVGV
RAATANTGCWDLSSGNKKWIIQVPILASIVLNFILFLNIVRVLATKLRETNAGRCDTRQQ
YRKLLKSTLVLMPLFGVHYIVFMATPYTEVSGTLWQVQMHYEMLFNSFQGFFVAIIYCFC
NGEVQAEIKKSWSRWTLALDFKRKARSGSSSYSYGPMVSHTSVTNVGPRAGLGLPLSPRL
LPAAATNGHLQQPSHTKPGATAPETAAPAAAAPKDDGLLGGSCSGLDEDAAPERPPALLQ
EEWETVM
Download sequence
Identical sequences ENSDNOP00000024340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]