SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024402 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024402
Domain Number 1 Region: 4-121
Classification Level Classification E-value
Superfamily Hormone receptor domain 3.14e-29
Family Hormone receptor domain 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024402   Gene: ENSDNOG00000032127   Transcript: ENSDNOT00000040108
Sequence length 335
Comment pep:known_by_projection scaffold:Dasnov3.0:JH565822.1:21:2328:1 gene:ENSDNOG00000032127 transcript:ENSDNOT00000040108 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFLFEKWKLYGDQCHYNLSLLPPPAELVCNRTFDRYSCWPDTPPNTTARVSCPWYLPWH
HKVQHRHVFKRCGPDGRWVRGPQGQPWRNASQCQVDAGELKVQREAAQMYRSFQATYTVG
YCLSLGALLLALAVLLGLSQLHCTRTYIHMHLFASFALRASSVLAVDALLKTRYSEKLGD
DLSVSVWLSDGAAAGCRVAAVLMQYGVVANYSWLLVEGLHLHRLLGCSAFPGRSCFALYM
GIGWGEWGAGGGAGWPGAVGPAPPSPPGTPVLFVVPGAVLKCLFENVQCWTSNDHMGFWW
VPRVPVFLAVLVRDAAPAGAWGGGGWGHRRLSPPR
Download sequence
Identical sequences ENSDNOP00000024402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]