SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024502 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024502
Domain Number 1 Region: 58-261
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.55e-54
Family BCR-homology GTPase activation domain (BH-domain) 0.00015
Further Details:      
 
Domain Number 2 Region: 28-64
Classification Level Classification E-value
Superfamily PH domain-like 0.00000172
Family Pleckstrin-homology domain (PH domain) 0.0095
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000024502
Domain Number - Region: 564-661
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.000419
Family FCH domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024502   Gene: ENSDNOG00000031230   Transcript: ENSDNOT00000051457
Sequence length 675
Comment pep:known_by_projection scaffold:Dasnov3.0:JH571343.1:4126376:4184905:1 gene:ENSDNOG00000031230 transcript:ENSDNOT00000051457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMGDLWLNACTLRCYCLFTGGDRDRMTAHHESYLLMASTQNDMEDWVKSIRRVIWGPFGG
GIFGQKLEDTVRYEKRYGNRLAPLLVEQCVDFIRQRGLKEEGLFRLPGQANLVKELQDAF
DCGEKPSFDSNTDVHTVASLLKLYLRELPEPVIPYAKYEDFLSCAKMLGKEEEAGVKELE
KQVKSLPVVNYNLLKYICSPFLNEVQSYSGVNKMSAQNLATVFGPNILRPKVEDPLTIME
GNTLVVQQLMSMMISKHDRLFPKDADCKQGPDGMSNNNNEIQKKTTMGQLQNKENNNTKD
SPGRRCSWDLNPPQRSSIDNGSPTGSKTNSPRNSVHKLDVSRSPPLMVKKNPAFNKGSGI
VTNGSFSSSNAEGLEKTQTTPNGSLQTRRTSSLKGSGTKMGTHSVQNGTVRMGILNSDTL
GNPVNGRMSWLPNGYVTLRDTKQKEHAGEAGQSNRLSTYDNVHQQFSVMNLDDKQSVDSA
TWSTSSCEISLPENSNSCRSSTTTCPEQDFYGGNFEDPVLDGPPQDDLSHPGDYESKSDR
RSVGGRSSRATSSSDNSETFVGNSTSNHSALHSLVSSLKQEMTKQKIEYESRIKSLEQRN
LTLETEMMSLHDELDQERKKFTMIEIKMRNAERAKEDAEKRNDMLQKEMEQFFSTFGELT
VEPRRTERGNTIWIQ
Download sequence
Identical sequences ENSDNOP00000024502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]