SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000024686 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000024686
Domain Number 1 Region: 150-172,218-239
Classification Level Classification E-value
Superfamily SH3-domain 0.00000673
Family SH3-domain 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000024686   Gene: ENSDNOG00000044707   Transcript: ENSDNOT00000041644
Sequence length 248
Comment pep:novel scaffold:Dasnov3.0:JH568511.1:741514:742295:1 gene:ENSDNOG00000044707 transcript:ENSDNOT00000041644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMNIQKKKVFQRETGILTTNKNASRTHKIRAPSNLEHLSGYVDHGVKHVTNQTARTGTPL
RTNIPTQKPPSPPMSGQRTLGQNSPYKTLEPVKPPTVPNDYPISVSRLGNKHSPSASLNQ
RPKTQSGNNGGNGSQNSGSISIGIPIVVPTPPPPTIGPLSNSPTPLPPPPPDVIPMFDDF
LLLPPPPPVGCEDEEAAIVQYNDPKADGEPACVPNNYIEKVVVLYDCTKDKDDELSFVEC
VIKNDEGW
Download sequence
Identical sequences ENSDNOP00000024686

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]