SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025091 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025091
Domain Number 1 Region: 147-278
Classification Level Classification E-value
Superfamily TNF-like 3.73e-42
Family TNF-like 0.000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025091   Gene: ENSDNOG00000046746   Transcript: ENSDNOT00000036942
Sequence length 280
Comment pep:known_by_projection scaffold:Dasnov3.0:JH572424.1:1065939:1092170:-1 gene:ENSDNOG00000046746 transcript:ENSDNOT00000036942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVPPRRSSWRREKAPRESKKAARRGAGQVWILGLRMLLLQAVLLLLALPSHGQDTTTQ
EEPGVLLLPPKGACVIAGIPGLPGHNGIPGRDGRDGVPGQKGEKGDTGLLGPKGDSGEIG
VSGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLEARVTVPNVPIRFTKIFYNQQSHYD
DTTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLH
LEMGDQVWLQVYESGEQMGLYADNVNDSTFTGFLLYHDIE
Download sequence
Identical sequences ENSDNOP00000025091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]