SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025123 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025123
Domain Number 1 Region: 10-71
Classification Level Classification E-value
Superfamily RING/U-box 0.00000000000000152
Family RING finger domain, C3HC4 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025123   Gene: ENSDNOG00000046536   Transcript: ENSDNOT00000047312
Sequence length 216
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568714.1:9760:10410:1 gene:ENSDNOG00000046536 transcript:ENSDNOT00000047312 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSEGESKDSSGSECPVCYEKFRDLEGASRTLSCGHVFCHDCLVKYLLSTRVDGQVQRIIV
CPICRYVTFLSKKSSRWPSMLDKSSQTLAVPAGQPSVPPPDTLGHTNPLAVSQPTWRPNQ
PRLPGSPSTQFPLELLPGLPREPQIFVISRHGMPLGEQDSVLPQSSLAELSGASPARSST
RSFCCRSRALLLITFIAVVAVVAAILPWILLVRKQA
Download sequence
Identical sequences ENSDNOP00000025123 XP_004462471.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]