SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025131 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025131
Domain Number 1 Region: 27-339
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.8e-56
Family FCH domain 0.0044
Further Details:      
 
Domain Number 2 Region: 502-661
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.63e-44
Family BCR-homology GTPase activation domain (BH-domain) 0.00016
Further Details:      
 
Domain Number 3 Region: 707-764
Classification Level Classification E-value
Superfamily SH3-domain 2.89e-16
Family SH3-domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025131   Gene: ENSDNOG00000048684   Transcript: ENSDNOT00000049818
Sequence length 899
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582165.1:709833:725845:1 gene:ENSDNOG00000048684 transcript:ENSDNOT00000049818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHGKLRRERGPQADYEAQVKEMRWQLSEQLRCLELQGDIRRELLQELAEFMRRRAEVE
QEYSRGLEKLAERFSSRGGRLGGGSREHQSFRKEPSLLSPLHCWAVLLQQTRQQSRESAV
LSEVLAGPLAQRLSHIAEDVGRLVRKSKDLEQQLQEELLVVVSELQTARKTYQVYRTESV
NAETKLREAERQEEKRAGRSAPAAAAPDAGPLRKGSIKKGGRLVEKRQAKFLEHKLKCTK
ARNEYLLSLASVNAAVSNYYLRDVLDLMDCCDTGFHLAVGQVLRSYAAAESRTQASQMQG
LGSLEEAVEALDPPGDKAKVLELHAAAFCPPQRFDYQPHDGDEVAELQVELELRDEILPR
AQNIQSRLDRQTIETEEVNKTLKATVQALLELVASDDGEVLDAFQASPSTESLKSTGSDP
GARQPGRRRGQHQDTETFYITKLQEYLSGRSILAKLQAKHTSLQEAIQRGDKENCEVSRA
QYTQRRLQRSRQPRPSSQYNQKLFGGDMEKFIQSSGQPVPLVVESCIRFINLHGLQHEGI
FRVSGAQLRVSEMRDAFERGEDPLVGGCSAHDLDSVAGVLKLYFRSLEPPLFPPDLFAEL
LASTELEAGPERAEQVSRLLARLPGPVLVVLRYLFTFLNHLAQYSDENMMDPYNLAVCFG
PRRNGTPPSPASATPDRRDAQLESAAGDNEPELEAGVPAQEDDLDGVVEAVACFSYTGRT
AQELTFQRGDVLRLHARASDDWWRGEHAGTRGLIPHKYITLPAGAEKHPAQAAGELLGSP
EGLLVEPGGRPEPWTPLETPGASGLRWHGLVPASPERHPVEVDKAVAQTMDSVFKELLGK
TAGRQGLGPASPSSPSPGPRSPQPLAPGRHGRHKGFFRSPGSPASPSAARPPGPDLKPH
Download sequence
Identical sequences ENSDNOP00000025131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]