SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000025417 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000025417
Domain Number 1 Region: 12-52
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000235
Family alpha-catenin/vinculin 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000025417   Gene: ENSDNOG00000043768   Transcript: ENSDNOT00000042939
Sequence length 84
Comment pep:novel scaffold:Dasnov3.0:JH570374.1:4721687:4723032:-1 gene:ENSDNOG00000043768 transcript:ENSDNOT00000042939 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVLITCFYFKFQFQRTFESLKNVSNKSDLQKTYQKLGKELENLDYLAFKRQQVGVRTLLG
GREHFKLPAVMTVRVYSEKRPNFH
Download sequence
Identical sequences ENSDNOP00000025417

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]