SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Dasypus novemcinctus 76_2 > ENSDNOP00000025757

Domain assignment for ENSDNOP00000025757 from Dasypus novemcinctus 76_2

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSDNOP00000025757
Domain Number 1	Region: 426-483
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	9.93e-27
Family	Classic zinc finger, C2H2	0.0039
Further Details:

Domain Number 2	Region: 342-399
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	1.72e-25
Family	Classic zinc finger, C2H2	0.0068
Further Details:

Domain Number 3	Region: 286-343
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.3e-25
Family	Classic zinc finger, C2H2	0.0052
Further Details:

Domain Number 4	Region: 230-287
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	2.16e-23
Family	Classic zinc finger, C2H2	0.004
Further Details:

Domain Number 5	Region: 472-524
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.35e-20
Family	Classic zinc finger, C2H2	0.0039
Further Details:

Domain Number 6	Region: 192-244
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	3.7e-20
Family	Classic zinc finger, C2H2	0.0045
Further Details:

Domain Number 7	Region: 389-421
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.000000000117
Family	Classic zinc finger, C2H2	0.0065
Further Details:

Weak hits

Sequence:	ENSDNOP00000025757
Domain Number -	Region: 157-201
Classification Level	Classification	E-value
Superfamily	beta-beta-alpha zinc fingers	0.00506
Family	Classic zinc finger, C2H2	0.015
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSDNOP00000025757 Gene: ENSDNOG00000048008 Transcript: ENSDNOT00000039279
Sequence length	533
Comment	pep:known_by_projection scaffold:Dasnov3.0:JH564544.1:287470:294730:1 gene:ENSDNOG00000048008 transcript:ENSDNOT00000039279 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	MISKLEKGEEPCLGKGKRPSKANLSETVRPKQIEANGKEIQQDDPVEKHQESQNKLFSKV TFKKKTLTKKKDHECSSLGKKNNVSIKHVPSKKRFLKFDSHGKSLKKNLPSHIRKCAKKK PDAAKEQRKPFSHNLSNKKKDKTQTDKRHEKLSSNSSSCTNWDKIHTGEKDEKSSSQGSS PTKHDKTQARLKPYECNQCGKILSHKQGLIDHQRIHTGEKPYECNECGIAFSQKSHLVVH QRVHTGEKPYECIQCGKAHSHKHALTDHLRIHTGEKPYECTECGKTFRHSSNLIQHVRSH TGEKPYECKECGKSFRYNSSLTEHVRTHTGEIPYECNECGKAFKYSSSLTKHMRIHTGEK PFKCNECEKAFSKKSHLIIHQRTHTKEKPYKCNDCGKAFGHSSSLTYHMRTHTGESPFEC SQCGKAFKQIEGLTQHQRVHTGEKPYECQECGKAFSQKSHLIVHQRTHTGEKPYECNECG KAFPAKSQLVIHQRSHTREKPYECSECGKAFKQNASLTKHVKIHSEEKSDQLN
Download sequence
Identical sequences	ENSDNOP00000025757

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]