SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026216 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000026216
Domain Number - Region: 80-119
Classification Level Classification E-value
Superfamily Hormone receptor domain 0.00549
Family Hormone receptor domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026216   Gene: ENSDNOG00000042077   Transcript: ENSDNOT00000033209
Sequence length 1009
Comment pep:known_by_projection scaffold:Dasnov3.0:JH567805.1:7670:16047:1 gene:ENSDNOG00000042077 transcript:ENSDNOT00000033209 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PSRLPGPATSPPLSTTTTARPTPLTSTASPAATTPLRRAPLTTHPVSAINQLGLDLPPAT
APAPSTRRPPAPNLHVSPELFCEPREVRRVQWPATQQGMLVERPCPKGTRGIASFQCLPA
LGLWNPRGPDLSNCTSPWVNQVAQKIKSGENAANIASELARHTRGAIYAGDVSSSVKLME
QLLDILDAQLQALRPVERESAGKNYNKMHKRERTCKDYIKAVVETVDNLLRPEALESWKD
MNATEQVHTATMLLDVLEEGAFLLADNVREPARFLAARQNVVLEVTVLNTEGQVQELVFP
QEYPSENSIQLSANTIKQNSRNGVVKVVFILYNNLGLFLSTENATVKLAGEAGAGSASLV
VNSQVIAASINKESSRVFLMDPVLFTVAHLEAKNHFNANCSFWNYSERSMLGYWSTHGCR
LVDSNKTHTTCACSHLTNFAVLMAHLIVVSPSAALPIPRPSPVLRLAWRPALRGAAFTPR
GGGPRRARREPLGARVVGKVDTVPCWPRRHGALNAGPRHLGGACRGGQGRGRGGGCRPGR
APGPAPCLPPPQVNLVFLMVTLHKMIRSSSVLKPDSSRLDNIKSWALGAIALLFLLGLTW
AFGLLFINKESVVMAYLFTTFNAFQGVFIFVFHCALQKKVHKEYSKCLRHSYCCIRSPPG
GAHGSLKTSAMRSNPRYYTGTQSRIRRMWNDTVRKQTESSFMAGDINSTPTLNRGTMGNH
LLTNPVLQPRGGTSPYNXPPGSGLSALPSGLQILSLCSKLCRPQRPLGGREACGMDTLPL
NGNFNNSYSLRSGEFPPGDGGPEPPRGRNLADAAAFEKMIISELVHNNLRGAGAAKGPPP
PEPPGPPVPGGGGEEEAGGPGGADRAEIELLYKALEEPLLLPRAQSVLYQSDLDESESCT
AEDGATSRPLSSPPGRDSLYASGANLRDSPSYPDSSPEGPSEALPPPPPAPPGPPEIYYT
SRPPALVARNPLQGYYQVRRPSHEGYLAAPGLEGPGPDGDGQMQLVTSL
Download sequence
Identical sequences ENSDNOP00000026216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]