SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026325 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000026325
Domain Number 1 Region: 62-201
Classification Level Classification E-value
Superfamily TNF-like 2.06e-38
Family TNF-like 0.00000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026325   Gene: ENSDNOG00000048100   Transcript: ENSDNOT00000040116
Sequence length 206
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569934.1:93613:95045:-1 gene:ENSDNOG00000048100 transcript:ENSDNOT00000040116 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRPGRFRLLRARGPLLLLLLGMLLDLAPGAQGLAGAGLAPASASRAAHQHPRKHSARGA
LRPAAHLVGDPGTQNSLRWRANTDRAFLRHGFALSNNSLLVPASGLYFVYSQVVFSGDGC
PPKATAVPPYLAHEVQLLSPQYRSHVPLLSAQKTVCPGQQGPWEHSVYQGAVFLLTRGDQ
LSTRTDGISHLLLRPSSVFFGGASAL
Download sequence
Identical sequences ENSDNOP00000026325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]