SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026453 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000026453
Domain Number 1 Region: 68-190
Classification Level Classification E-value
Superfamily TNF-like 2.02e-27
Family TNF-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026453   Gene: ENSDNOG00000040894   Transcript: ENSDNOT00000045710
Sequence length 196
Comment pep:novel scaffold:Dasnov3.0:JH576441.1:2215576:2219450:-1 gene:ENSDNOG00000040894 transcript:ENSDNOT00000045710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGVWILIISVLMANVVIEQVVCIGLPGPPGLQGPPGLAGVRGYPGPMGPPGISGPEGEN
IKCPCREKSAFTMKFNGRLPPPSKPVVFTHVLYNDERDLNEDTGVFICRLPGSYYFHFDV
ELQHCKVKISLMRNQTQVMEKHQVSKKEYENISGAVLMPLKKGEKVWLEAEVENEEPNKA
EVIIYFTGFLTGYLKL
Download sequence
Identical sequences XP_004477829.1.11602 ENSDNOP00000026453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]