SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000026646 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000026646
Domain Number 1 Region: 153-283
Classification Level Classification E-value
Superfamily TNF-like 3.42e-35
Family TNF-like 0.00035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000026646   Gene: ENSDNOG00000047974   Transcript: ENSDNOT00000031646
Sequence length 289
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568325.1:1317928:1335663:1 gene:ENSDNOG00000047974 transcript:ENSDNOT00000031646 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGACGRALGCCLLLALACGPALGRVPRGQQAPRDQEKTQGDAREEATKEPPRPLEPAERV
GENPERGHLTGGDGELPASRCFRCCDPAGPVYPPLHLPQINITILKGEKGDRGDRGLQGK
YGKTGSAGARGHVGPKGQKGSMGAPGDRCKTHYAAFSVGRKKPLHSNDYYQTVIFDTEFV
NLYGHFNMFTGRFYCYVPGIYFFSLNVHTWNQKETYLHIMRNGEEAAILYAQVSDRSIMQ
SQSLMLELREQDEVWVRLFKGERENAIFSDEFDTYITFSGYLVKHATEP
Download sequence
Identical sequences XP_004460507.1.11602 ENSDNOP00000026646 ENSDNOP00000034726

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]