SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027112 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027112
Domain Number 1 Region: 51-176
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.57e-22
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 
Domain Number 2 Region: 220-271
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000366
Family CUE domain 0.00088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027112   Gene: ENSDNOG00000037247   Transcript: ENSDNOT00000034009
Sequence length 274
Comment pep:known_by_projection scaffold:Dasnov3.0:JH582224.1:44122:61479:-1 gene:ENSDNOG00000037247 transcript:ENSDNOT00000034009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAGTPHSEMGKVYLGELPQDFLRIAPTQQQQQIQLDAQAAQQLQYGAAVGTVGRLSITVV
QAKLAKNYGMTRMDPYCRVRLGYAVYETPTAHNGAKNPRWNKVIQCTVPPGVDSFYLEIF
DERAFSMDDRIAWTHITIPESLRQGHVEDEWYSLSGRQGDDKEGMINLVLSYTPLPAAMM
MPPQPVVLMPTVYQQGVGYVPITGMPAVCSPGVVPVAVAPPAASAQPRCSGEDLRAIQDM
FPNMDKEVIRSVLEAQRGDKDAAINSLLQMGEES
Download sequence
Identical sequences ENSDNOP00000027112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]