SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027157 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000027157
Domain Number - Region: 149-188
Classification Level Classification E-value
Superfamily UBA-like 0.000561
Family CUE domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027157   Gene: ENSDNOG00000041757   Transcript: ENSDNOT00000046496
Sequence length 287
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578031.1:591266:600878:1 gene:ENSDNOG00000041757 transcript:ENSDNOT00000046496 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELERIVSAALLAFVQTHLPEADLSGLDEVIFSYVLGVLEDLGPSGLSEENFDMEAFTEM
MEAYVPGFAHIPRGTIGDMMQKLSGQLSDARNKENLQPQSSGVQEQVPISSEPLQRPEKV
KEEIRSSPTVAGETQDKATSAEEELLPGVDVLLEMFPTCSVGQAEWVLAKARGDLEEAVQ
MLVEGKEEGPQAWDSPNQDLPRRLRGPQKDELKSFILQKYMMVDSADDQKIHRPMAPREA
PKKLIRYIDNQVVSTKGERFKDVRNPEAEEMKATYINLKPARKYRFH
Download sequence
Identical sequences XP_004478916.1.11602 XP_004478917.1.11602 ENSDNOP00000027157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]