SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027708 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027708
Domain Number 1 Region: 110-241
Classification Level Classification E-value
Superfamily TNF-like 2.49e-42
Family TNF-like 0.000000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027708   Gene: ENSDNOG00000046746   Transcript: ENSDNOT00000030677
Sequence length 243
Comment pep:known_by_projection scaffold:Dasnov3.0:JH572424.1:1065939:1076932:-1 gene:ENSDNOG00000046746 transcript:ENSDNOT00000030677 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLLLQAVLLLLALPSHGQDTTTQEEPGVLLLPPKGACVIAGIPGLPGHNGIPGRDGRDGV
PGQKGEKGDTGLLGPKGDSGEIGVSGVEGPRGFPGIPGRKGEPGESAYVYRSAFSVGLEA
RVTVPNVPIRFTKIFYNQQSHYDDTTGKFHCNIPGLYYFSYHITVYMKDVKVSLFKKDKA
VLFTYDQYQEKNVDQASGSVLLHLEMGDQVWLQVYESGEQMGLYADNVNDSTFTGFLLYH
DIE
Download sequence
Identical sequences XP_004473749.1.11602 XP_004473750.1.11602 XP_004473751.1.11602 XP_012386534.1.11602 ENSDNOP00000027708

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]