SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027856 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027856
Domain Number 1 Region: 469-694
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.13e-66
Family Ankyrin repeat 0.00000000183
Further Details:      
 
Domain Number 2 Region: 974-1060
Classification Level Classification E-value
Superfamily SH2 domain 6.84e-45
Family SH2 domain 0.0000134
Further Details:      
 
Domain Number 3 Region: 888-973
Classification Level Classification E-value
Superfamily EF-hand 4.76e-37
Family EF-hand modules in multidomain proteins 0.0000951
Further Details:      
 
Domain Number 4 Region: 1066-1143
Classification Level Classification E-value
Superfamily RING/U-box 6.03e-37
Family RING finger domain, C3HC4 0.00011
Further Details:      
 
Domain Number 5 Region: 794-887
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 4.05e-25
Family N-terminal domain of cbl (N-cbl) 0.0011
Further Details:      
 
Domain Number 6 Region: 23-126
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000888
Family V set domains (antibody variable domain-like) 0.0065
Further Details:      
 
Domain Number 7 Region: 318-420
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000649
Family V set domains (antibody variable domain-like) 0.0071
Further Details:      
 
Domain Number 8 Region: 239-310
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000964
Family I set domains 0.029
Further Details:      
 
Domain Number 9 Region: 139-222
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000532
Family I set domains 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027856   Gene: ENSDNOG00000034007   Transcript: ENSDNOT00000038968
Sequence length 1206
Comment pep:known_by_projection scaffold:Dasnov3.0:JH583344.1:14980:82097:1 gene:ENSDNOG00000034007 transcript:ENSDNOT00000038968 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALTGHGWLLLSATFLGAAAEISITPEPAQPAEGDNLTLVARGLSGELLAYNWYAGPALS
LAYLVASYIVSTGDETPGPAHTGREAVGPDGSLEIQGVLPSHSGTYILQTLNRQFQTEVG
YGHVQVYEILTQPVVLANNTALVERRDTLRLVCSSPGTAKVRWFFNGETLPITLRLGLSP
DCRVLTRHGVLREEAGAYQCEVWNPVSASRSEPINLTVYYGPERVAILQDSTTRTGCTIK
VDFNTSLTLWCVSRSCPEPEYVWAFNGRALKNGQDHLNISSMTAAQEGTYTCIVKNAKTL
LSGSASVVVKLSAAAVAMTIVPVPTKPMEGQDVTLTVLGYPKDLLVYAWYRGPASEPNRL
LSQLPSGNWIAGPAHTGREVGFPNCSLLVQKLNLTDAGRYTLKTVTLQGKTETLEVEMQV
ARPLLPLYPTPTMGSPFPLLSLPAPLYPMVCSMEHPLSADIAMATCADEDGDTPLHIAVV
QGNLPAVHRLVSLFQHGGRELDIYNNLRQTPLHLAVITTLPSVVRLLVTAGASPMALDRH
GQTAAHLACEHRSPTCLRALLDSAAPGTVDLEARNYDGLTALHVAVNAECHEAVLLLLEL
GADIDSVDIKSGRSPLIHAVENNSLSTVQLLLQHGANVNAQMYSGSSALHSASGRGLLPL
VRTLVRSGADSGLKNCHNDTPLTVARSRRVIDILRGKATRPAPTTQGPAPSPCPLHPALR
SPHSWSHSPSAGLLSASPSSSPSQSPPKDPPGFPLAPPNFFLPSSSPPAFLPFAGVLRAP
GRPVPLSPAPGGRLLRQVAHARRAAGRSDSEGPGGAGDFLAVYLTNLEAKGRQVAALLPP
RGQTGTESELFLEGSRLRRQLAKLALIFSHMHAELGALFPDGQYCGHTYQLTKAPAHTFW
RECCGARCVLPWDEFESLLCTRHPIEPGATALALRSTIDLTCNGHVSVFEFDIFTRLFQP
WPTLLKNWQLLAVSHPGYMAFLTYDEVHARLQACRDKPGSYIFRPSCTRLGHWAIGYVNT
DGSILQTIPLKRPLFQALLEGQKEGFYLYPDGKSHNPDLTELCRMQPQQHIQVPEEQLQL
YWAMDSTFEVCKICAENDKDVKIEPCGHLLCSRCLATWQHTDSRTCPFCRCEIKGQEAVS
VHQLPGRPAEARATAEDPGDSSDLEDGEGELGEVVSSAPPLPPRLDLPPRGPRSGDQPKA
VSQTPA
Download sequence
Identical sequences ENSDNOP00000027856

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]