SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027946 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027946
Domain Number 1 Region: 209-405
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.89e-49
Family BCR-homology GTPase activation domain (BH-domain) 0.00013
Further Details:      
 
Domain Number 2 Region: 2-97,126-189
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.78e-37
Family BAR domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027946   Gene: ENSDNOG00000042706   Transcript: ENSDNOT00000040833
Sequence length 615
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564263.1:212406:225906:-1 gene:ENSDNOG00000042706 transcript:ENSDNOT00000040833 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDKRVKKLPLMALSTTMAESFKELDPDSSMGKALEMSCAIQNQLACSLAEFEMTLEKDVL
QPLSRLSEEELPAILKHKKSLQKLVSDWNTLKSRLSQAAKNSGSGQGLGGGPSSYSSAAT
ANKVETLKEEEEELKRRVEQCKDEYLADLYHFATKEDTYANYFIHLLEIQADYHRKSLSS
LDTALAELRENHSRADPSPLMTATPFSRVYGVSLGTHLQGLGRAIALPIEACVMMLLSEG
MKEEGLFRLAAGASVLKRLKQTMASDPRGLEEFCSDPHAVAGALKSYLRELPEPLMTFDL
YDDWMRAASLKEPGARLEALREVCSRLPQENLSNLRYLMKFLARLAEEQEVNKMTPSNIA
IVLGPNLLWPPEKEGDQAQLDAASVSSIQVVGVVEALIQNADTLFPGDINFNVSGLFSAL
APQEKDHEKPAPEELPATPTPASALAPAPASVATKERMESEAPPRPASPKVSRSSPETAP
PAEDTARRTKRPAPARPTMLPPQVSSTRSSPPVPTPPPGPLSPVTPQAMPRRMVGSSLRA
PTVPPPLPPMPPQPARRQSRRSPASPSARASGMPAQADLGATTEEGGAPEPVGGVTTPPA
SPPQPRPRSLASETD
Download sequence
Identical sequences ENSDNOP00000027946 ENSDNOP00000030759 XP_004451662.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]