SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000027985 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000027985
Domain Number 1 Region: 25-157
Classification Level Classification E-value
Superfamily Hormone receptor domain 4.58e-28
Family Hormone receptor domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000027985
Domain Number - Region: 110-300
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0275
Family Rhodopsin-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000027985   Gene: ENSDNOG00000003054   Transcript: ENSDNOT00000042315
Sequence length 332
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569388.1:57154:110533:-1 gene:ENSDNOG00000003054 transcript:ENSDNOT00000042315 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSGAGANGHVSGLSWEWILQPQNMLLVLQLDADGTITIEEQIVLVLKAKVQCELNITAQL
QEGAEGNCFPEWDGLICWPRGIVGKISAVPCPPYVYDFNHKGVAFRHCNPNGTWDFMHHL
NKTWANYSECLHLLQPDISLGKQEFFERLYVMYTVGYSISFGSLAVAILTIGYFRRLHCT
RNYIHMHLFVSFMLRAASIFVKDRVVHAHIGAKELQSLLLQDDLQNSIGTLSVDKSQYIG
CKIAMVMFIYFLATNYYWILVEGLYLHSLIFVAFFSDTKYLWGFTLIGWGFPAAFVVAWA
VARATLADARCWELSAGGIKWIYQAPILAAIG
Download sequence
Identical sequences ENSDNOP00000027985

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]