SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000028538 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000028538
Domain Number 1 Region: 2-191
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 6.63e-63
Family BAR domain 0.0000000124
Further Details:      
 
Domain Number 2 Region: 234-297
Classification Level Classification E-value
Superfamily SH3-domain 1.58e-23
Family SH3-domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000028538   Gene: ENSDNOG00000030625   Transcript: ENSDNOT00000032086
Sequence length 302
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569410.1:2119009:2367711:1 gene:ENSDNOG00000030625 transcript:ENSDNOT00000032086 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTKTIEYLQPNPASRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNF
GPALGDVGEAMRELSEVKDSLDMEVKQNFIDPLQNLHDKDLREIQHHLKKLEGRRLDFDY
KKKRQGKIPDEELRQALEKFDESKEIAESSMFNLLEMDIEQVSQLSALVQAQLEYHKQAV
QILQQVTVRLEERIRQASSQPRREYQPKPRMSLEFPTGDSTQPNGGLSHVGTPKPAGAPM
DQPCCRALYDFEPENEGELGFKEGDIITLTNQIDENWYEGMLHGQSGFFPINYVEILVAL
PH
Download sequence
Identical sequences ENSDNOP00000028538

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]