SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000028780 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000028780
Domain Number 1 Region: 113-230
Classification Level Classification E-value
Superfamily Hormone receptor domain 6.67e-17
Family Hormone receptor domain 0.0054
Further Details:      
 
Domain Number 2 Region: 43-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000402
Family I set domains 0.022
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000028780
Domain Number - Region: 565-652,725-741
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00706
Family Voltage-gated potassium channels 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000028780   Gene: ENSDNOG00000041007   Transcript: ENSDNOT00000032890
Sequence length 1124
Comment pep:known_by_projection scaffold:Dasnov3.0:JH576397.1:968211:1042910:1 gene:ENSDNOG00000041007 transcript:ENSDNOT00000032890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHRWVKERNITVRDTRCAYPKSLQAQPVTGVRQELLTCDPPLELPSFYMTPSHRQVVFEG
DSLPFQCMASYIDQDMQVLWYQDGRIVETDEAQGIFVEKNMIHNCSLIASALTISNIQAG
STGNWGCHVQTKRGNNTRTVDIVVLESSAQYCPPERVVNNKGDFRWPRTLAGITAYLQCT
RSNHGSGIYPGNPQDERKAWRRCDRGGFWADDDYSRCQYANDVTRVLYMFNQMPLNLTNA
VATARQLLAYTVEAANFSDKMDVIFVAEMIEKFGRFTKEEKSKELGDVMVDIASNIMLAD
ERVLWLAQKEAKACSRIVQCLQRIATYRLANGAHVYSTYSPNIALEAYVIKATGFTGMTC
TVFQKVAASDRTGLSDYGRRDPDGNLDKQLSFKCNVSNTFSSLALKNTIIEASIQLPPSL
FSPKQKREVRPTDDSLYKLQLIAFRNGKLFPATGNSTNLADDGKRRTVVTPVILTKIDGV
NADTHPIPVNVTLRRIAHGADAVAAQWDFDLLNGQGGWKSDGCHILYSDENITTIQCYSL
SNYAVLMDLTGSELYTQAAVLLHPVVYTTAVILLLCLLAVIVSYIYHHSLIRISLKSWHM
LVNLCFHIFLTCVVFVGGITQTRNASVCQAVGIILHYSTLATVLWVGVTARNIYKQVTKK
AKSCQDPDEPPPPPRPMLRFYLIGGGIPIIVCGITAAANIKNYGSRPHAPYCWMAWEPSL
GAFYGPASFITFVNCMYFLSIFIQLKRHPERKYELKEPTEEQQRLAVNENGEINHQDSMS
LSLISTSALENEHTFHSQLLGASLTLLLYVALWMFGALAVSLYYPLDLVFSFFFGATCLS
FSAFLMVHHCINREDVRLAWIMTCCPGRSSYSVQVNIQPPSSSGTNGEPPKCTNSSAESS
CTNKSASSFKNSSQGCKLTNLQAAAAQCHASSLPLNSMPQLDNSLTEHSMDNDIKMHVAP
LEVQFRTNVHPSRHHKNRSKGHRASRLTVLREYAYDVPTSVEGSVQNGLPKSRPGSNEGH
SRSRKAYLAYRERQYNPPQQDSSDACSTLPKSSRNFEKPVSTSSKKDALRKPIAAELESQ
QKSYGLNLAIQNGPIKSNGQDGPLLGTDSTGNVRTGLWKHETTV
Download sequence
Identical sequences XP_004477816.1.11602 XP_004477817.1.11602 XP_012374831.1.11602 ENSDNOP00000028780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]