SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000029229 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000029229
Domain Number 1 Region: 88-135
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 4.18e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 320-364
Classification Level Classification E-value
Superfamily UBA-like 0.000000995
Family CUE domain 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000029229   Gene: ENSDNOG00000036462   Transcript: ENSDNOT00000045062
Sequence length 498
Comment pep:known_by_projection scaffold:Dasnov3.0:JH566723.1:1469862:1479014:1 gene:ENSDNOG00000036462 transcript:ENSDNOT00000045062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FSGMEQSQCGSSDRSGSDRPLLAPGLVAAAAPPPSPVPPGMPVPPAFLRPPGLFLRAAAA
AAAAATGSGGCPAPGLERGVGAVTCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACA
KCTLIAERQRVMAAQVALRRQQAQEESEARGLQRLLYSGPSGPGGRASAGSGRAEAVQAP
GGPAAVAALGLGSLRRAGAVATPAFEAFHPDHPGEKQEQKMGKYDSYQRGQGEPVSKSHQ
LSLVSSSKSNGVIGKQNNRSSISEKSNKNDSILSPNPEEQSGGEESPRSLSSSDLESGNE
SEWAKDFTATRSSLPTLSSRPRDPLDILTKIFPSYRRSWLEGILQFCKGDVVQAIEQVLN
GKEHKPDTRDLASSGKSEHIAFQRANFSLTGIGFGALGNKSAFSPLQTSSASYGGDSSFY
SLNPRLGMSPLRLAYSSPGRGLSSFIPPYLTSGLVPALPFRSALDYSFSGMIRDCSYLPI
KDSVMGSGLYSRPNQDNQ
Download sequence
Identical sequences ENSDNOP00000029229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]