SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000029560 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000029560
Domain Number 1 Region: 178-311
Classification Level Classification E-value
Superfamily PH domain-like 1.59e-39
Family Pleckstrin-homology domain (PH domain) 0.000000944
Further Details:      
 
Domain Number 2 Region: 394-505
Classification Level Classification E-value
Superfamily SH2 domain 4.44e-24
Family SH2 domain 0.00000695
Further Details:      
 
Domain Number 3 Region: 26-87
Classification Level Classification E-value
Superfamily Phenylalanine zipper 3.79e-22
Family Adapter protein APS, dimerisation domain 0.0000285
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000029560   Gene: ENSDNOG00000042447   Transcript: ENSDNOT00000032679
Sequence length 648
Comment pep:known_by_projection scaffold:Dasnov3.0:JH562474.1:625884:636833:-1 gene:ENSDNOG00000042447 transcript:ENSDNOT00000032679 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PAAAGGCDGPGAMNGAAPGAAATPVPDWRGFCELHAQAAAVDFARQFCRFLRENPAYDTP
DAGASFSRHFAANFLDAFGEEVRRVLAAERPDAMEPAAGPAALKAAACGHSRSSEDVSAH
AAAKARVRKGFSLRNMSLCVVDGVRDMWHRRASPEPEAGAAPRAAEPPAEQRDKWTRRLR
LSRTLAAKVELVDIQREGALRFMVADDAAAGLGGAAQWQKCRLLLRRAVAGERFRLEFFV
PPKASRPKVSIPLSAVTEVRTTMPLEMPEKDNTFVLKVENGAEYILETIDSLQKHSWVAD
IQGCVDPGDSEEDVELSCARGGCLASRVASCSCELLADAADLARPPETTAAVGAVVTAPH
SRAREAASESLVHVPLETFLQTLESPGGSGGDSNNTGEEEADPEPKPEPEPQLSDYPWFH
GTLSRAKAAQLVLAGGPRNHGLFVIRQSETRPGEYVLTFNFQGKAKHLRLSLNGHGQCHV
QHLWFQSVLDMLRHFHTHPIPLESGGSADITLRSYVRAQGPPPGKRPHLAPAATHPPGPA
EWGLGAAGAPSIQVLRDFWAAAGWGCSQAARGPCTAVAARVPVRARPPLPSCARRLPRKP
ARPRRSARGRSDSAERLLEPAGGGDEPPEAGEGARGRARAVENQYSFY
Download sequence
Identical sequences ENSDNOP00000029560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]