SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030072 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030072
Domain Number 1 Region: 387-463
Classification Level Classification E-value
Superfamily SH2 domain 0.000000000000277
Family SH2 domain 0.002
Further Details:      
 
Domain Number 2 Region: 31-84
Classification Level Classification E-value
Superfamily PH domain-like 0.000000735
Family Pleckstrin-homology domain (PH domain) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030072   Gene: ENSDNOG00000039809   Transcript: ENSDNOT00000042663
Sequence length 469
Comment pep:novel scaffold:Dasnov3.0:JH580249.1:853502:860536:-1 gene:ENSDNOG00000039809 transcript:ENSDNOT00000042663 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSGEAGRRRDRGCRAHRVMRAAEETTSNNVFPFKIIHISKKHRTWFFSASSEDERKSWM
VLLRREIGHFHEKKEPPPDASDSSSDADSFYGAVERPVDISLSPYPTDNEDYEHDDEDDS
YMEPDSPEPGRPEDALIHPPAYPPPPVPRKPVFSEVPRAHSFTSKGPGPLLPPPPPKRGL
PEAGLAPDDAKRDPLGLRAPRAPAASRRMSDPPPAAPGPWKAPCARELAGHGPCAAAAAA
ARNCDKLKSFHLTPRGPPPPEPANKPKCLKAAEAALTRDAPRPGPFLPPVAPKPALKLPA
SEATRPEGLPRPEKPPLPHLQRSPPDGQSFRSFSFEKPRRPSQADAGGEDSDEDYEKAPL
PVDPAPTAWLQGLVLGGXFKATSPRGEPQDGLYCIRNSSTKSGKVLVVWDESSGKVRNYR
IFEKDSKFYLEGEALFASVGSLVEHYHTHVLPSHDSLRLRHPYGYAGPR
Download sequence
Identical sequences ENSDNOP00000030072

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]