SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030220 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030220
Domain Number 1 Region: 168-271
Classification Level Classification E-value
Superfamily SH3-domain 1.71e-23
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 2 Region: 2-84
Classification Level Classification E-value
Superfamily PX domain 8.01e-19
Family PX domain 0.00068
Further Details:      
 
Domain Number 3 Region: 98-159
Classification Level Classification E-value
Superfamily SH3-domain 2.63e-17
Family SH3-domain 0.0004
Further Details:      
 
Domain Number 4 Region: 309-392
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000119
Family SH3-domain 0.00094
Further Details:      
 
Domain Number 5 Region: 783-849
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000459
Family SH3-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030220   Gene: ENSDNOG00000046535   Transcript: ENSDNOT00000043239
Sequence length 851
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569242.1:718308:776997:1 gene:ENSDNOG00000046535 transcript:ENSDNOT00000043239 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQMLDKFPMEGGQKDPKQRIIPFLPGKILFRRSHIRDVAVKRLIPIDEYCKALIQLPPYI
SQCDEVLQFFETRPEDLNPPKEEHTGKKKSGGDLTSVDPMVLEQYVVVANYQKQESSEIS
LSVGQVVDIIEKNESGWWFVSTAEEQGWVPATCLEGQDGVQDEFSLQPEEEEKYTVIYPY
TARDQDEMNLEKGAMVEVIQKNLEGWWKIRHQGKEGWAPASYLKKSSGEPLPPKPVPGSS
THSGALDLDGTFRQQNAAGREKELLNNQRDSRFEGRPVPDGDVKQRSPRMRQRPPPRRDM
TIPRGLNLPKPPIPPQVEEEYYTIAEFQTTIPDGISFQAGLKVEVIEKNLSGWWYIQIEE
KEGWAPATFIDKYKKTSNASRPNFLAPLPNEVAQLRLGDAAAVENHTASDAVGPSRPLPE
APPGPGDSGVPWSKDWKGSKEVLRKVSADTSASTGYEEISDLNLEEKPSLPPRKESIIKS
EGELQERERQRMEQLRGSSPKPPGMSLPMIPAKHNPPARDNRRPEPKPDKSKLFQLKNEM
GLECGHKVLAKEVKKPNLRPISKSKADPPEEKPEAIPQNPFLKSKLQVRPKPASPRTEPP
QGEDQVDICNLRSKLRPAKAQEKSSLDRESPHAAGGQDMAFSRSFLPGEGPGRAQEKTGK
QDGLGPKEASSRASPKPAKTADPVPRSAPVPLQEPPPQRPMVPPRRPPPPKKSSSSSRPL
PEVRGPQREASEDKAAPAPGWPLLIPPKPKPFLPNSLGGQDDMRGKGGPGPRVAGKVGES
RGPLPSTNGPKDSLYVAVANFEGDEDTSSFQEGTVFEVREKNSSGWWFCQALSGAPSWEG
WIPSSYLRKKL
Download sequence
Identical sequences ENSDNOP00000030220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]