SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030358 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030358
Domain Number 1 Region: 6-248
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 4.97e-70
Family IMD domain 0.00000000433
Further Details:      
 
Domain Number 2 Region: 390-452
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000197
Family SH3-domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030358   Gene: ENSDNOG00000044151   Transcript: ENSDNOT00000050405
Sequence length 549
Comment pep:known_by_projection scaffold:Dasnov3.0:JH565942.1:234613:288509:-1 gene:ENSDNOG00000044151 transcript:ENSDNOT00000050405 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LNLMRSKRVTRRNRSVYKXTIMEQFNPSLRNFIAMGKNYEKALAGVTYAAKGYFDALVKM
GELASESQGSKELGDVLFQMAEVHRQVQAQLEDMLKSFHNELLTQLEQKVELDSRYLSAA
LKKYQTEQRSKGDALDKCQAELKKLRKKSQGSKNPQKYSDKELQYIDAISSKQGELESCP
TATRRALTEERRRLCSLVEKQCAVARSAAAPPRQVQGKELLAQKLPLWQQACADPNKIPE
RAVQLMQQVASSNGAVLPGALSASKSNLLISDPIPGAKPLPVPPELAPFVGQLGSRCSGP
ECSAFGRGRGTGAGGSGDPPQKLQEGQGPSSSRAQRRRLGGAATTARVPRLAALPKALAR
PLTLFSSVRAAENKTLPRSSSMAAGLERNGRTRVKAIFSHAAGDNSTLLSFKEGDLITLL
VPEARDGWHYGESEKTKMRGWFPFSYTRVLDGDGGDRLHMSLQQGRSSSTGDLLDKEDLA
LPPPDYGTSSRAFPAQPAGTFKQRPYSVAVPAFTQGLEDYGARSVSRNPFAGVQLRPTLT
KDRSAPLLS
Download sequence
Identical sequences ENSDNOP00000030358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]