SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030412 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030412
Domain Number 1 Region: 3-93
Classification Level Classification E-value
Superfamily SET domain 1.14e-21
Family Histone lysine methyltransferases 0.052
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000030412
Domain Number - Region: 108-148
Classification Level Classification E-value
Superfamily Tubulin chaperone cofactor A 0.0186
Family Tubulin chaperone cofactor A 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030412   Gene: ENSDNOG00000031226   Transcript: ENSDNOT00000045522
Sequence length 182
Comment pep:novel scaffold:Dasnov3.0:JH568330.1:445253:590154:1 gene:ENSDNOG00000031226 transcript:ENSDNOT00000045522 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVICNSFTICNAELQDVGVGLYPSMSLLNHSCDPNCCIVFSGPHLFLRAVKAIELGEELT
ICYLDVLTTRAERQQLLRDQYCFSCDCLRCQSQDKDAEMLAGDEQVWKEVQESLKKIEEL
KAQRKWEQTLALCRAVLGDSSARLPDSNVYQLKVLDCALDACINLGLWEEALLYGLRTLE
PY
Download sequence
Identical sequences ENSDNOP00000030412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]