SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030441 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030441
Domain Number 1 Region: 132-264
Classification Level Classification E-value
Superfamily TNF-like 1.7e-34
Family TNF-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030441   Gene: ENSDNOG00000031976   Transcript: ENSDNOT00000043592
Sequence length 267
Comment pep:known_by_projection scaffold:Dasnov3.0:JH561505.1:95900:129351:-1 gene:ENSDNOG00000031976 transcript:ENSDNOT00000043592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTVALSPHWAVLLLPLLVYGVSTEEPTTGEAVTSNSPGGCRMCCDSVDSLAPADAADVS
VASPSALPYILPEVRPYINITILKGDKGDRGPLGTPGKLGKDGLRGDRGPQGTKGAKGQA
GSPGSPCQLRFSAFSVGRKAALHSSEGFQPLLFDTVFVNPDGHFDMAAGHFAAPLRGLYF
FSLNVHSWNFKETYVHVVHNEEAAVILYAQPSDRSIMQSQSVMLALAPGDRVWVRLFKRE
RENAVYSDDVDTYITFSGHLIKPEDDD
Download sequence
Identical sequences ENSDNOP00000030441 XP_004447084.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]