SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030477 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030477
Domain Number 1 Region: 99-256
Classification Level Classification E-value
Superfamily TNF-like 1.13e-38
Family TNF-like 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030477   Gene: ENSDNOG00000033887   Transcript: ENSDNOT00000031840
Sequence length 256
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568905.1:4492959:4507514:1 gene:ENSDNOG00000033887 transcript:ENSDNOT00000031840 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGDLGLDFGESASMEMLPEEGIHRPKARGALEARSGSLLWALTCCMVALPLLTGLTTYV
LVGQLRVQGEACLFKTPKGQEFGPSPQQAYAPPRTDGDKPRAHLTVVRQTSTQHLKNQFP
ALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQITFRGTASECGKINQQSQLNKPD
SIIVIVTKVTDSYPLPTQLLTGTKSVCEIGTNWFQPIYLGAVFSLQEGDKLVVNVSDISL
VDYTKEDKTFFGAFLL
Download sequence
Identical sequences A0A0U5J867
XP_004463222.1.11602 ENSDNOP00000030477

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]