SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030609 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000030609
Domain Number 1 Region: 6-288
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 2.14e-69
Family FCH domain 0.0029
Further Details:      
 
Domain Number 2 Region: 351-412
Classification Level Classification E-value
Superfamily SH3-domain 3.68e-22
Family SH3-domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030609   Gene: ENSDNOG00000041932   Transcript: ENSDNOT00000046556
Sequence length 413
Comment pep:known_by_projection scaffold:Dasnov3.0:JH569975.1:732328:772397:-1 gene:ENSDNOG00000041932 transcript:ENSDNOT00000046556 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMPQLQFRDAFWCRDFTAHTGYEVLLQRLLDGRKMCKDVEDLLRQRAQAEERYGKELVQI
ARKAGGQSEINSLRASFDSMKQQLENVGSLHIQLALALREELRSLEEFRERQKEQRKKYE
AVMDRVQKSKLSLYKKTMESKKSYEQKCRDADDAEQAFERISANGHQKQVEKSQNKAKQC
KDSATEAERVYRQNIEQLEKVRGEWEQEHRTTCEAFQLQEFDRLTILRNALWVHCNQLSM
QCVKDDELYEEVRLTLEGCSVDADIDGFIQLKSTGAEPPAPVTYHNYYDREVTPSGSPGT
QPSCGMMKRFSGLLHGSPKITAIPAVSTETLTPTPERNEGVYAAIAVQETPGPPVPAAQD
YKALYDYTAQNSDELDISAGDILVVILEGEDGWWTVERNGQRGFVPGSYLEKL
Download sequence
Identical sequences ENSDNOP00000030609 XP_004468228.1.11602

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]