SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000030673 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000030673
Domain Number - Region: 100-280
Classification Level Classification E-value
Superfamily Tubby C-terminal domain-like 0.0017
Family At5g01750-like 0.033
Further Details:      
 
Domain Number - Region: 20-116
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0136
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000030673   Gene: ENSDNOG00000045326   Transcript: ENSDNOT00000048851
Sequence length 291
Comment pep:known_by_projection scaffold:Dasnov3.0:JH578663.1:288910:302825:-1 gene:ENSDNOG00000045326 transcript:ENSDNOT00000048851 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GPPGTAVLPSAGYPGVLPVGYYSPHQPSTFPLHQPASGVRPVQYQPGKYPMPNQPAPTMW
MPGPAPMPNCPPGLECLTQLDNIHVLQHFEPLEMFTGFETNNRYDVKNNSNQMVYVVNED
TDDFTRNAYKTLRPFVLRVTDCLGREVITMQRPFRCTCCCFCCPSARQELEVQCPPGVTI
GFVAEHWNLCRAIYSIQNEKKENVLSVRGPCLTYGCGSDSVFEVTSLDGVTGVGSIVRKW
NGLLSAMADADHFDIHFPLDLDVKMKAMIFGACFLIDFMYFERSSHRRSSN
Download sequence
Identical sequences ENSDNOP00000030673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]