SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031019 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031019
Domain Number 1 Region: 4-283
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 2.75e-53
Family Rhodopsin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031019   Gene: ENSDNOG00000039952   Transcript: ENSDNOT00000052171
Sequence length 293
Comment pep:novel scaffold:Dasnov3.0:JH568965.1:4675:6074:-1 gene:ENSDNOG00000039952 transcript:ENSDNOT00000052171 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KTIAMENDSLVIEFILVGFTDKPDLLLPLFFLFLMNYVITVMRNLSLINLIYLNSHLHTP
MYIFTFTFSFILCHSFVLTPKMLMSFVSEKNIVSFAGCMSQLFFFCFFVHSECYVLTAMA
CDCYVICKPLLYMVTMSPQACFLLMFGSYVMGFAGAMIHTRDMVRLYFCDFNIINHYIIN
QLSSEMDYTVVVTVVIVSSFIIFISYALILSNIIHISSDEGWSKAFSTCGSHVITVALFY
GSCISRPLLLVLWVQVFYTHVVPMLNPLIYSLRNKDVKHALKRQTEERKNEEG
Download sequence
Identical sequences ENSDNOP00000031019

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]