SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031242 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSDNOP00000031242
Domain Number - Region: 16-60
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0471
Family alpha-catenin/vinculin 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031242   Gene: ENSDNOG00000047927   Transcript: ENSDNOT00000034881
Sequence length 115
Comment pep:novel scaffold:Dasnov3.0:JH570009.1:1157568:1157915:1 gene:ENSDNOG00000047927 transcript:ENSDNOT00000034881 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEDNKQLALRIDGAVQSASQEVTNLRAELTATNRRLAELSGGGPGPGPGATASASAAAD
AATANMENHPHGAQGRDRRGARGGGKAGAEPARRRRGTRGPHPHAPGEIAALCGL
Download sequence
Identical sequences ENSDNOP00000031242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]