SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031429 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031429
Domain Number 1 Region: 147-263
Classification Level Classification E-value
Superfamily SET domain 0.000000000965
Family Viral histone H3 Lysine 27 Methyltransferase 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031429   Gene: ENSDNOG00000046457   Transcript: ENSDNOT00000049311
Sequence length 271
Comment pep:known_by_projection scaffold:Dasnov3.0:JH568731.1:27918:28761:1 gene:ENSDNOG00000046457 transcript:ENSDNOT00000049311 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RTTYVPAKISSYVSPNDCSGSQVPGKPVAGIYRRQKKRNTGANTEPPKSEEQIKDASRGL
APFPNQKSETAEPPKLLPRPVILQYSCHQPPEGKQAPRKTAQGKTQENRKRRRFYPARRS
PRLKSLKKGKELTESAEEEGRKMDRLDGEGRGMVATEQVSGARLRWSATGTASRSPRREA
GGSARTGPSTGCYMYYFQYTSKTYCVDASREKNRLGRLMDHSKCGNCQTKRTTSAGSHVI
LAAFCGTEAGKELLYDCGDRSKVPSEPTLAE
Download sequence
Identical sequences ENSDNOP00000031429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]