SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031457 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031457
Domain Number 1 Region: 80-286
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.97e-49
Family DBL homology domain (DH-domain) 0.00019
Further Details:      
 
Domain Number 2 Region: 333-507
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.4e-38
Family BAR domain 0.0059
Further Details:      
 
Domain Number 3 Region: 715-771
Classification Level Classification E-value
Superfamily SH3-domain 8.66e-16
Family SH3-domain 0.0003
Further Details:      
 
Domain Number 4 Region: 570-656
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000000223
Family SH3-domain 0.0000762
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031457   Gene: ENSDNOG00000031825   Transcript: ENSDNOT00000047164
Sequence length 777
Comment pep:known_by_projection scaffold:Dasnov3.0:JH575175.1:5313796:5479558:-1 gene:ENSDNOG00000031825 transcript:ENSDNOT00000047164 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPREATGKENMGTKKRNLTFLRPRLYMLERRKTDTVVESSVSGDHAGTLRRSQSDRTEY
NQKLQEKMTPPAGHPAAETSAQKEEQQMRMMAKRSKIIKELIQTEKDYLNDLQLCVREVV
QPLRNKQIDRLDVDSLFSNIESVHQISAKLLSLLEEATTDVEPAMQVIGEVFLQMKGPLE
DIYKIYCYHHDEAHSILESYEREEELKQHLSHCIQSLRKIYMKEGKPSLLDMGSLMIKPI
QRVMKYPLLLCELQNSTPASHPDYRALEDACAAVKDINVNINELKRRKDLVLKYKKNDED
ESLKDKLSKLNIHSISKKSKRVTNHLKILTRGESQVKDNAFNREEKLFRCLEKTMRHFVK
NTSFCLLHVQDAMPLVLQSVKEFQEISYNKDEEENGYSETPSNAPNPCDDFAAHLQRVVL
TPLSALLSLFPGPQKLIQKRYDKLLDYNSYLQRAAGDESGLAKKEYEALNAQLVEELQVF
NQAARRILLDCLCSFITLLRDLMLLVQRVYFTVGPVPMLASNISEIQNQVLEEVQNLNFV
KDNSTTFIERKLSFEKKKPVQILPEMPRQTDVHRSKLLSTYSTEELFQAKRKCNATQEYD
ISLLEGELVAVVEQKDPLGSTSRWLVDTGIVKGYVYSSFLKPYNPAKVQKVDTENRFCGD
DFDNISLFVSSRLASDSVTGTPEGSISDSSSSLSGTCGKFETNGTDIDSFQEVDEQIFYA
VHAFQARSDHELSLQEYQRVHILRFCDLSGNKEWWLAEAQGQKGYVPANYLGKMTYA
Download sequence
Identical sequences XP_004476279.1.11602 ENSDNOP00000031457

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]