SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031628 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031628
Domain Number 1 Region: 59-327
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 7.85e-32
Family FCH domain 0.0058
Further Details:      
 
Domain Number 2 Region: 575-637
Classification Level Classification E-value
Superfamily SH3-domain 8.14e-16
Family SH3-domain 0.0018
Further Details:      
 
Domain Number 3 Region: 482-555
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000722
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031628   Gene: ENSDNOG00000043146   Transcript: ENSDNOT00000037781
Sequence length 717
Comment pep:known_by_projection scaffold:Dasnov3.0:JH564669.1:677612:691455:-1 gene:ENSDNOG00000043146 transcript:ENSDNOT00000037781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SRVAGWAGAEMQPPPRKVKPAQEVKLRFLEQLSNFQTWQQKEADLLEDIRNNNTVPSCRI
VLERELGLALQKLAGPFLKREGHRSGEMDSRPSLGRSRTVFGTWRCLLDATVAGGQARLQ
ASDRYRDLAGGTGRSAKEQVLRKGAENLQRAQAEVLQSVRELSRSRKLYGQRERVWALAQ
EKVADVQARLNRSDHGLFHTRTSLQKLSTKLSAQSAQYSQQLRAARNEYLLNLAATNALL
DHYYQEELPALLKIPTWFCLQDLVSELSEHLRDPLTLLSRTELEAAEMALEHARHGGQAA
SQVSWEQDLKLLQEPGVFSPIPPQQFQPAGTDQVCVLELEGGAGGVPGESGLEKEVQRWT
SRAVRDYKIQHHGQLVLQRLEQRRQQVQEREAPGIEQRLQEVRENIRRAQVSQVKGAARL
ALLQAVGLDVQHWLKPAMTQAQDEVEQERRLSEARLSQRDLSPTAEDAELSDFEECEEAG
ELFEETAPPALTTRPLPCPAHVVFGYQAGREDELTITEGEWLEVIEEGDADEWVKARNQR
GEVGFVPERYLNFSDFSLPERGHDSDSLSGAEPTAFLARALYSYTAQSAEELSFPEGALI
RLLPGPQDGVDDGFWRGEFGGHVGVFPSLLVEELLGPPGLPESSDLEQTLPSPSPPSFSP
PVPTSALDGPPAPVLPGDQHLDCPGPLDLMAPRLRPMRPPPPPPTKAPDPDHPEPLT
Download sequence
Identical sequences ENSDNOP00000031628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]