SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSDNOP00000031663 from Dasypus novemcinctus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSDNOP00000031663
Domain Number 1 Region: 92-183
Classification Level Classification E-value
Superfamily PH domain-like 0.000000000209
Family Pleckstrin-homology domain (PH domain) 0.0008
Further Details:      
 
Weak hits

Sequence:  ENSDNOP00000031663
Domain Number - Region: 7-25
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00576
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSDNOP00000031663   Gene: ENSDNOG00000048677   Transcript: ENSDNOT00000037717
Sequence length 242
Comment pep:known_by_projection scaffold:Dasnov3.0:JH579792.1:1584135:1585221:-1 gene:ENSDNOG00000048677 transcript:ENSDNOT00000037717 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QGLKREGCGLNYHKQCVFKIPNNCNCLGKVAFNAEPSSLGTDTDVPMNTDSSDMNSDGIH
GLSNIKEPSPPEDKKFFLDPSDLDVERDEEAVKTIRERDIIVDSKCLRLFQNKYGSKYYK
EIPLSEILCVSVPQHFKNISQGNSPQCVSRNNGDSSHNPVLAATGAGLDVAQRWERAICQ
ALMPVTSKTSIFTSQGQGVDHKDRSQSMSVFNCQMQANVICTIYQIFVNELGSGQCGIVY
GG
Download sequence
Identical sequences ENSDNOP00000031663

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]